Protein coding transcript 261582

• Transcript: Ll_transcript_256845
• CDS coordinates: 1-630 (+)
• Peptide sequence: LFLPGIDGVGLGLTLHHQKLGSIFDVWCLHIPVADRTPFTEFVKIVEKTVRSEHQRLPNRPIYLVGESLGGCLAMAVAAHIPDIDVVLILANPATSFGRSQLQLLTPLLEAMRGPLSLFPPEILSSLSGDPLRLLDKLVSGFPLQNTDREILEDFTTFSGSLPVLANILPIETLQWKLKLLKSASAYVNSRLHAIKAQTLILCSGNDQLL
• ORF Type: internal

Annotations of Ll_transcript_256845

• Blastp: Acyltransferase-like protein At3g26840, chloroplastic from Arabidopsis with 50.46% of identity
• Blastx: Acyltransferase-like protein At3g26840, chloroplastic from Arabidopsis with 50.46% of identity
• Eggnog: Acyltransferase(COG0204)
• Kegg: Link to kegg annotations (AT3G26840)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019437419.1)
• Pfam: alpha/beta hydrolase fold (PF00561.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;