Protein coding transcript 261583

• Transcript: Ll_transcript_256864
• CDS coordinates: 459-782 (+)
• Peptide sequence: MEAMHGPLSLFPPEILSSISGDPLKLLDNLVRGFPLQNTAKELLEDFITFSGSLPVLANILPIETLQWKLKLLKSGSAYVNSRLHAIKAQTLILCRFMLFDLSILYHS
• ORF Type: 3prime_partial

Annotations of Ll_transcript_256864

• Blastp: Acyltransferase-like protein At1g54570, chloroplastic from Arabidopsis with 43.18% of identity
• Blastx: Acyltransferase-like protein At3g26840, chloroplastic from Arabidopsis with 68.42% of identity
• Eggnog: Acyltransferase(COG0204)
• Kegg: Link to kegg annotations (AT1G54570)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019437420.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;