Protein coding transcript 261588

• Transcript: Ll_transcript_256853
• CDS coordinates: 142-576 (+)
• Peptide sequence: MAAIGASLSPAASFPVYSCQEPSQTVMKLKAKRIPIMPPRFALSVDRVAETSTTAIPPNNGILSVKVNGEEGTLAEKVKRSENKKDEEEEELNRRSGWRSYVEQSKEIAKPDGGPPRWFSPLESGSRLDKSPLLLFLPGIDGVGL
• ORF Type: 3prime_partial

Annotations of Ll_transcript_256853

• Blastp: Acyltransferase-like protein At3g26840, chloroplastic from Arabidopsis with 41.38% of identity
• Blastx: Acyltransferase-like protein At3g26840, chloroplastic from Arabidopsis with 44.59% of identity
• Eggnog: Acyltransferase(COG0204)
• Kegg: Link to kegg annotations (AT3G26840)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019437419.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;