Protein coding transcript 26161

• Transcript: Ll_transcript_521592
• CDS coordinates: 207-689 (+)
• Peptide sequence: MNGGDEVVAAPAGPPNPLDWKFSQVFGERTAGEEVQEVDIISAIEFYKSGDYLATGDRGGRVVLFERTDTKDHGGSRRDLERMEYSISRHPEFRYKTEFQSHEPEFDYLKSLEIEEKINKIKWCQTPNDALFLLSTNDKTIKFWKVQEKKVKKISEMNVDP
• ORF Type: 3prime_partial

Annotations of Ll_transcript_521592

• Blastp: Serine/threonine protein phosphatase 2A 55 kDa regulatory subunit B beta isoform from Arabidopsis with 84.47% of identity
• Blastx: Serine/threonine protein phosphatase 2A 55 kDa regulatory subunit B beta isoform from Arabidopsis with 84.47% of identity
• Eggnog: protein phosphatase type 2A regulator activity(COG5170)
• Kegg: Link to kegg annotations (AT1G17720)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019448196.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;