Protein coding transcript 261617

• Transcript: Ll_transcript_13665
• CDS coordinates: 337-1533 (+)
• Peptide sequence: MMMAAESALSFSVASVVEDVLQQHGTRLKDLDLEYRKTEEAASRRYEAAVWLRKMVGVVAAKDLPAEPSEEEFRFGLRSGIILCNVINKVQSGSVPKVVESPIDSALIPDGAPLSAYQYFENVRNFLVAVQEIGIPTFEASDLEQGGKSSRIVNCVLALKSYSEWKQTGGNGVWKFGGTLKPAISTKSFVRKNSEPFTNSLSRTSSTNEKSLTALNSDIESNKMSGSHSLSMLVRAILSNKKPEEVPMFVESVLSKVVEEFEHRIESRGEQTKITSRGSVSQSKGSVSKVLMADKKVENKIHMVTKEEDFIRKNDITAEESHSQVLKKQMFFDQQQRDIQELKHTLHNAKAGMKFMQMKFHEEFSNLGMQIDDLAHAASGYHRVLEENRILYNQVQDLK
• ORF Type: 3prime_partial

Annotations of Ll_transcript_13665

• Blastp: Kinesin-like protein KIN-14I from Arabidopsis with 62.28% of identity
• Blastx: Kinesin-like protein KIN-14I from Arabidopsis with 62.28% of identity
• Eggnog: Kinesin family member(COG5059)
• Kegg: Link to kegg annotations (AT2G47500)
• CantataDB: Link to cantataDB annotations (CNT0002121)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019440738.1)
• Pfam: Calponin homology (CH) domain (PF00307.30)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;