Protein coding transcript 261619

• Transcript: Ll_transcript_13668
• CDS coordinates: 2-325 (+)
• Peptide sequence: SNIPMLTEKEGFIHKNHVADEESQRQLQKKRMLFDQQQRDIQELKHTLHTTKAGMQFMQMKFHEEFSNLGMHIHGLAHTASGYHRVLEENRKLYNQVQDLKGSIRVYC
• ORF Type: internal

Annotations of Ll_transcript_13668

• Blastp: Kinesin-like protein KIN-14I from Arabidopsis with 69.47% of identity
• Blastx: Kinesin-like protein KIN-14I from Arabidopsis with 69.47% of identity
• Eggnog: Kinesin family member(COG5059)
• Kegg: Link to kegg annotations (AT2G47500)
• CantataDB: Link to cantataDB annotations (CNT0002121)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019452371.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;