Protein coding transcript 26164

• Transcript: Ll_transcript_521599
• CDS coordinates: 294-1073 (+)
• Peptide sequence: MNGADEVVAAPAGPPNPLDWKFSQVFGERTAGEEVQEVDIISAIEFCKSGDYLATGDRGGRVVLFERTDTKDHGDSRRDLERMDYSITRHPEFRYKTEFQSHEPEFDYLKSLEIEEKINKIRWCQTANGALFLLSTNDKTIKFWKVQEKKVKKISEMNVDPLKGTGNGSIASSSSSTIHLANGGSPEKSRNYPSNDFSFPPGGIPSLKLPTVVSSHETSLVARCRRVYAHAHDYHINSISNNSDGETFISADDLRINLWN
• ORF Type: 3prime_partial

Annotations of Ll_transcript_521599

• Blastp: Serine/threonine protein phosphatase 2A 55 kDa regulatory subunit B beta isoform from Arabidopsis with 78.16% of identity
• Blastx: Serine/threonine protein phosphatase 2A 55 kDa regulatory subunit B beta isoform from Arabidopsis with 77.31% of identity
• Eggnog: protein phosphatase type 2A regulator activity(COG5170)
• Kegg: Link to kegg annotations (AT1G17720)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019458559.1)
• Pfam: WD domain, G-beta repeat (PF00400.31)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;