Transcript | Ll_transcript_521599 |
---|---|
CDS coordinates | 294-1073 (+) |
Peptide sequence | MNGADEVVAAPAGPPNPLDWKFSQVFGERTAGEEVQEVDIISAIEFCKSGDYLATGDRGGRVVLFERTDTKDHGDSRRDLERMDYSITRHPEFRYKTEFQSHEPEFDYLKSLEIEEKINKIRWCQTANGALFLLSTNDKTIKFWKVQEKKVKKISEMNVDPLKGTGNGSIASSSSSTIHLANGGSPEKSRNYPSNDFSFPPGGIPSLKLPTVVSSHETSLVARCRRVYAHAHDYHINSISNNSDGETFISADDLRINLWN |
ORF Type | 3prime_partial |
Blastp | Serine/threonine protein phosphatase 2A 55 kDa regulatory subunit B beta isoform from Arabidopsis with 78.16% of identity |
---|---|
Blastx | Serine/threonine protein phosphatase 2A 55 kDa regulatory subunit B beta isoform from Arabidopsis with 77.31% of identity |
Eggnog | protein phosphatase type 2A regulator activity(COG5170) |
Kegg | Link to kegg annotations (AT1G17720) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019458559.1) |
Pfam | WD domain, G-beta repeat (PF00400.31) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer