Protein coding transcript 261644

• Transcript: Ll_transcript_13680
• CDS coordinates: 2-391 (+)
• Peptide sequence: VVGKFVEFYGDGMGKLSLADRATIANMSPEYGATMGFFPVDHVTLQYLKLTGRSDEPVAMIESYLRANNMFVDYNEPQQDRVYSSYLELNLSDVEPCISGPKRPHDRVPLKEMKADWHSCLDSKVGFKGF
• ORF Type: internal

Annotations of Ll_transcript_13680

• Blastp: Aconitate hydratase 3, mitochondrial from Arabidopsis with 94.62% of identity
• Blastx: Aconitate hydratase 3, mitochondrial from Arabidopsis with 94.62% of identity
• Eggnog: aconitate hydratase(COG1048)
• Kegg: Link to kegg annotations (AT2G05710)
• CantataDB: Link to cantataDB annotations (CNT0000366)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019413160.1)
• Pfam: Aconitase family (aconitate hydratase) (PF00330.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;