Protein coding transcript 26167

• Transcript: Ll_transcript_521558
• CDS coordinates: 274-1005 (+)
• Peptide sequence: MNGGDEVIAAPAGPSNPLDWKFSQVFGERTAGEEVQEVDIISAIEFYKSGDYLATGDRGGRVVLFERTDTKDHGGSRRDLERMEYSISRHPEFRYKTEFQSHEPEFDYLKSLEIEEKINKIRWCQTANGALFLLSTNDKTIKFWKVQEKKVKKISEMNVDPLKGTGNGSIASSSSSTIHLANGGSPEKSRNYPSNDFSFPPGGIPSLKLPTVVSSHETSLVARCRRVYAHAHDYHINSISNNR*
• ORF Type: complete

Annotations of Ll_transcript_521558

• Blastp: Serine/threonine protein phosphatase 2A 55 kDa regulatory subunit B beta isoform from Arabidopsis with 76.95% of identity
• Blastx: Serine/threonine protein phosphatase 2A 55 kDa regulatory subunit B beta isoform from Arabidopsis with 76.03% of identity
• Eggnog: protein phosphatase type 2A regulator activity(COG5170)
• Kegg: Link to kegg annotations (AT1G17720)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019436482.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;