Protein coding transcript 261698

• Transcript: Ll_transcript_15942
• CDS coordinates: 735-1307 (+)
• Peptide sequence: MEARFGTEAYHYYDMGGGSHDLRGLGKRSTEWDLNEWRWDGDMFLASRLNPAVAAGVGQQFFPLGSGIPVAAVRSSGSPNGNSSCSEEADIENKKGNKEGERKRRVIVLEDDGLNEEAGALSLKLGGHGEHLAGREVASWDGVNGKKNRVGGGTSNRAVCQVEDCSADLTKAKDYHRRHKVCELHSKATNA
• ORF Type: 3prime_partial

Annotations of Ll_transcript_15942

• Blastp: Squamosa promoter-binding-like protein 1 from Arabidopsis with 40.93% of identity
• Blastx: Squamosa promoter-binding-like protein 1 from Arabidopsis with 41.97% of identity
• Eggnog: Squamosa promoter-binding-like protein(ENOG4110DQF)
• Kegg: Link to kegg annotations (AT2G47070)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019441265.1)
• Pfam: SBP domain (PF03110.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;