Protein coding transcript 261715

• Transcript: Ll_transcript_15658
• CDS coordinates: 3-374 (+)
• Peptide sequence: MNKLGGKANTGEGGEQPSRMEPLPDGSRNPKRSAIKQIASGRFGVSSYYLTNADELQIKMAQGAKPGEGGELPGHKVIGDIAVTRNSTPGVGLISPPPHHDIYSIEDLAQLIHDLKNANPAARI
• ORF Type: 3prime_partial

Annotations of Ll_transcript_15658

• Blastp: Glutamate synthase [NADH], amyloplastic from Medicago with 94.35% of identity
• Blastx: Glutamate synthase [NADH], amyloplastic from Medicago with 94.35% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_020212208.1)
• Pfam: Conserved region in glutamate synthase (PF01645.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;