Transcript | Ll_transcript_15609 |
---|---|
CDS coordinates | 437-898 (+) |
Peptide sequence | MTAIEEMAGMDVLCSDKTGTLTLNKLTVDKNLVEVFAKGVDADTVVLMAARASRLENQDAIDTAIVGMLADPKEARAGIHEIHFLPFNPTDKRTALTYTDSHGKMHRVSKGAPEQILNLAHNKADIEHRVHAVIDKFAERGLRSLAVAYQEVPD |
ORF Type | 3prime_partial |
Blastp | Plasma membrane ATPase 2 from Lycopersicon with 93.51% of identity |
---|---|
Blastx | Plasma membrane ATPase 1 from Lycopersicon with 91.88% of identity |
Eggnog | P-type atpase(COG0474) |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019464023.1) |
Pfam | Cation transport ATPase (P-type) (PF13246.5) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer