Protein coding transcript 261773

• Transcript: Ll_transcript_15586
• CDS coordinates: 1-693 (+)
• Peptide sequence: DGVYSGSTCKQGEIEAIVSATGVHTFFGKAAHLVDTTNQVGHFQKVLTAIGNFCICSIAVGMVIEIIVMYPIQDRQYRPGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKNLVEVFAKGVDADTVVLMAARASRLENQDAIDTAIVGMLADPKEARAGIHEIHFLPFKPTDKRTALTYTDSHGKMHRVSKG
• ORF Type: internal

Annotations of Ll_transcript_15586

• Blastp: Plasma membrane ATPase 1 from Lycopersicon with 93.07% of identity
• Blastx: Plasma membrane ATPase 1 from Lycopersicon with 93.07% of identity
• Eggnog: P-type atpase(COG0474)
• Kegg: Link to kegg annotations (543982)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019464023.1)
• Pfam: E1-E2 ATPase (PF00122.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;