Protein coding transcript 261776

• Transcript: Ll_transcript_15595
• CDS coordinates: 2-379 (+)
• Peptide sequence: KLAEIFTTGVVLGSYLAMMTVIFFWAAYKTDFFPRVFGVSSLEKTAHDDFRKLASAIYLQVSTISQALIFVTRSRGWSFVERPGLLLVFAFLVAQLVSYITFYFISIILHSIKFGDWFAACRLPL*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_15595

• Blastp: Plasma membrane ATPase 1 from Lycopersicon with 90% of identity
• Blastx: Plasma membrane ATPase 1 from Lycopersicon with 92.86% of identity
• Eggnog: P-type atpase(COG0474)
• Kegg: Link to kegg annotations (543982)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019451034.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;