Protein coding transcript 261790

• Transcript: Ll_transcript_14931
• CDS coordinates: 1-423 (+)
• Peptide sequence: KCAIGRERETAVCLMQKYIDKGSELQIRSVVALDHLKNYIYVEADKEAHVREACKGLRNIFGQKITLVPIREMTDVLSVESKAIDLARDTWVRMKIGTYKGDLAKVVDVDNVRQRVTVKLIPRIDLQALANKLEGREVVKK
• ORF Type: internal

Annotations of Ll_transcript_14931

• Blastp: Putative transcription elongation factor SPT5 homolog 1 from Arabidopsis with 88.03% of identity
• Blastx: Putative transcription elongation factor SPT5 homolog 1 from Arabidopsis with 88.03% of identity
• Eggnog: Transcription elongation factor(COG5164)
• Kegg: Link to kegg annotations (AT4G08350)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_004502577.1)
• Pfam: Early transcription elongation factor of RNA pol II, NGN section (PF03439.12)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;