Transcript | Ll_transcript_14129 |
---|---|
CDS coordinates | 3-632 (+) |
Peptide sequence | VMARWLQSAGLQHLASPLASTGIDQRFFPMQQGYGAPSAEEKQRLCKLMRNLNFNGESGSEPYTPTSKTFGGGAVLDGFGSPEFRGDLGAGLLDLHAMDDTELLSEHVISEPFDPSPFMPEGTRIFEDDFNSIGSKEREADADQSLFLPTDEKENNKRENNVAKIKVVVRKRPLNKKELAKKEDDVVTVYDSAYLTVHEPKLKGFLCWI* |
ORF Type | 5prime_partial |
Blastp | Kinesin-like protein KIN-13A from Arabidopsis with 67.15% of identity |
---|---|
Blastx | Kinesin-like protein KIN-13A from Arabidopsis with 87.25% of identity |
Eggnog | Kinesin family member(COG5059) |
Kegg | Link to kegg annotations (AT3G16630) |
CantataDB | Link to cantataDB annotations (CNT0000890) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019463570.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer