Protein coding transcript 261877

• Transcript: Ll_transcript_14154
• CDS coordinates: 3-632 (+)
• Peptide sequence: VMARWLQSAGLQHLASPLASTGIDQRFFPMQQGYGAPSAEEKQRLCKLMRNLNFNGESGSEPYTPTSKTFGGGAVLDGFGSPEFRGDLGAGLLDLHAMDDTELLSEHVISEPFDPSPFMPEGTRIFEDDFNSIGSKEREADADQSLFLPTDEKENNKRENNVAKIKVVVRKRPLNKKELAKKEDDVVTVYDSAYLTVHEPKLKGFLCWI*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_14154

• Blastp: Kinesin-like protein KIN-13A from Arabidopsis with 67.15% of identity
• Blastx: Kinesin-like protein KIN-13A from Arabidopsis with 88.51% of identity
• Eggnog: Kinesin family member(COG5059)
• Kegg: Link to kegg annotations (AT3G16630)
• CantataDB: Link to cantataDB annotations (CNT0000890)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019463570.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;