Protein coding transcript 261882

• Transcript: Ll_transcript_14164
• CDS coordinates: 365-712 (+)
• Peptide sequence: MTFVLTLFLMNMFPMMKYIELQYNQLFLQFLRGPKLHVLLTDRQVKSLLFAVHNYSCKNDKHHLILHFKSFSFLGITMQPLPLRAAGDLVRQLQQPVYRNQIFKLWRSYFEIYGGK
• ORF Type: 3prime_partial

Annotations of Ll_transcript_14164

• Blastp: Kinesin-like protein KIN-13A from Oryza sativa with 85% of identity
• Blastx: Kinesin-like protein KIN-13A from Oryza sativa with 85.45% of identity
• Eggnog: Kinesin family member(COG5059)
• Kegg: Link to kegg annotations (4337845)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019463570.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;