Protein coding transcript 261926

• Transcript: Ll_transcript_14698
• CDS coordinates: 1429-1734 (+)
• Peptide sequence: MQVYPSGSAIDSMHSDPSEKEDAQSSLNYSFKQGIHPPPTFGSSSNLETLPLQTTKNNIEDGGSAMGVKACFPRPMHEITFSTIDKPKLLSQVVNSDFIFL*
• ORF Type: complete

Annotations of Ll_transcript_14698

• Blastp: Serine/threonine-protein kinase STY17 from Arabidopsis with 49.48% of identity
• Blastx: Serine/threonine-protein kinase STY17 from Arabidopsis with 86.17% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: Link to kegg annotations (AT4G35780)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019421298.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;