Protein coding transcript 261932

• Transcript: Ll_transcript_14718
• CDS coordinates: 3134-3805 (+)
• Peptide sequence: MEISPHCIQIPSDGADVWEIDTNHLIYANRVGSGSFGDLYRGTYCSQDVAIKVLKPERISTDMLKEFAQEVYIMRKIRHKNVVQFIGACTRPPNLCIVTEFMSRGSLYDYLHKQRGVFKLQSLLKIAIDVSKGMNYLHQNNIIHRDLKTANLLMDENELVKVADFGVARVQTQSGVMTAETGTYRWMAPEVIEHKPYGQKADVFSFGISLWELLTGELPYSHLT
• ORF Type: 3prime_partial

Annotations of Ll_transcript_14718

• Blastp: Serine/threonine-protein kinase STY17 from Arabidopsis with 78.03% of identity
• Blastx: Serine/threonine-protein kinase STY17 from Arabidopsis with 72.14% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: Link to kegg annotations (AT4G35780)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019421298.1)
• Pfam: Protein tyrosine kinase (PF07714.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;