Protein coding transcript 261933

• Transcript: Ll_transcript_14719
• CDS coordinates: 3514-4122 (+)
• Peptide sequence: MEISPHCIQIPSDGADVWEIDTNHLIYANRVGSGSFGDLYRGTYCSQDVAIKVLKPERISTDMLKEFAQEVYIMRKIRHKNVVQFIGACTRPPNLCIVTEFMSRGSLYDYLHKQRGVFKLQSLLKIAIDVSKGMNYLHQNNIIHRDLKTANLLMDENELVKVADFGVARVQTQSGVMTAETGTYRWMAPELLDGTSDLFPMI*
• ORF Type: complete

Annotations of Ll_transcript_14719

• Blastp: Serine/threonine-protein kinase STY17 from Arabidopsis with 73.89% of identity
• Blastx: Serine/threonine-protein kinase STY8 from Arabidopsis with 67.53% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: Link to kegg annotations (AT4G35780)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019421298.1)
• Pfam: Protein tyrosine kinase (PF07714.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;