Protein coding transcript 261936

• Transcript: Ll_transcript_14725
• CDS coordinates: 1284-1748 (+)
• Peptide sequence: MQVYPSGSAIDSMHSDPSEKEDAQSSLNYSFKQGIHPPPTFGSSSNLETLPLQTTKNNIEDGGSAMGVKACFPRPMHEITFSTIDKPKLLSQLTSILGEMGLNILEAHAFSTTDGFSLDVFVVEGWPNEETEELKGVLEKEILKVKVHSPIMAV*
• ORF Type: complete

Annotations of Ll_transcript_14725

• Blastp: Serine/threonine-protein kinase STY17 from Arabidopsis with 60.14% of identity
• Blastx: Serine/threonine-protein kinase STY17 from Arabidopsis with 58.94% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: Link to kegg annotations (AT4G35780)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019421298.1)
• Pfam: ACT domain (PF01842.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;