Transcript | Ll_transcript_14691 |
---|---|
CDS coordinates | 1330-1731 (+) |
Peptide sequence | MQVYPSGSAIDSMHSDPSEKEDAQSSLNYSFKQGIHPPPTFGSSSNLETLPLQTTKNNIEDGGSAMGVKACFPRPMHEITFSTIDKPKLLSQLTSILGEMGLNILEAHAFSTTDGFSLDVFVVEGWPNEVGRK* |
ORF Type | complete |
Blastp | Serine/threonine-protein kinase STY17 from Arabidopsis with 59.54% of identity |
---|---|
Blastx | Serine/threonine-protein kinase STY17 from Arabidopsis with 71.18% of identity |
Eggnog | Serine Threonine protein kinase(COG0515) |
Kegg | Link to kegg annotations (AT4G35780) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019421298.1) |
Pfam | ACT domain (PF01842.24) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer