Protein coding transcript 261981

• Transcript: Ll_transcript_13604
• CDS coordinates: 269-943 (+)
• Peptide sequence: MISNSSRPLVRKKAALSLLRLYRKNPDVVNVDGWADRMTQLLDERDLGVLTSSMSLLVALVSNHHEAYWSCLPKCVKILERLARNQDIPQEYTYYGIPSPWLQVKAMRALQYFPVIEDPNIRRSLFEVLQRILMGTDVVKNVNKNNASHAVLFEALALVMHLDADKEMMSQCVALLGKFIAVREPNIRYLGLENMTRMLMVTDVQDIIKRHQAQIITSLKDPDIS
• ORF Type: 3prime_partial

Annotations of Ll_transcript_13604

• Blastp: AP-2 complex subunit alpha-1 from Arabidopsis with 90.67% of identity
• Blastx: AP-2 complex subunit alpha-1 from Arabidopsis with 91.02% of identity
• Eggnog: Adaptor-related protein complex 2, alpha(ENOG410XNQE)
• Kegg: Link to kegg annotations (AT5G22770)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019457942.1)
• Pfam: Adaptin N terminal region (PF01602.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;