Protein coding transcript 2620

• Transcript: Ll_transcript_524605
• CDS coordinates: 1-456 (+)
• Peptide sequence: ESMKDIIREEQIGEFLEAFYLFDKDGDGFISIEELGNAMRSVDENPTIEELQIMMKEGDMDGKGTMEFGEFLNLMAIKMKETEAEEEFKEAFRVFDKDQDGYISPIELMFVMRSIGVKVTEEELGLMMNEADLDGDGLIDYQEFVRMMLSV*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_524605

• Blastp: Calmodulin from Triticum with 61.49% of identity
• Blastx: Calmodulin from Triticum with 61.49% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019418735.1)
• Pfam: EF hand (PF00036.31)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;