Protein coding transcript 262030

• Transcript: Ll_transcript_15886
• CDS coordinates: 260-1303 (+)
• Peptide sequence: MKEVMKKLVVIAPTHRQLFVTELAEAVRNLTSSATDQLHIFCEAMKSLSTTSSDGAAVLRVLQALSSVVNSLTEKESDIVTRAVISQVWEINSALEPLWHELSCCIHKIESCSQSASDFFTLSSTSVSKPSGVIPSLPAGSQNILPYIESFFVVCEKLRPAQQGASHESIPVVSDVENASTSAIPQKLSGPAVKVDEKNAAFVRFSERHRKLLNAFLRQKSGLLEKSFSLMLKVPRFIDFDNKRAHFRSKIKPWRGHRRNRLKILVRRAYVLEDSYNQLRMRSTQDLKGRLKVHFQGEEGTDEGGLTREWYQLLSRVIFDKGALLFTTVGSESTFQPNPNYVYQTEHL
• ORF Type: 3prime_partial

Annotations of Ll_transcript_15886

• Blastp: E3 ubiquitin-protein ligase UPL2 from Arabidopsis with 50% of identity
• Blastx: E3 ubiquitin-protein ligase UPL2 from Arabidopsis with 50% of identity
• Eggnog: ubiquitin protein ligase(COG5021)
• Kegg: Link to kegg annotations (AT1G70320)
• CantataDB: Link to cantataDB annotations (CNT0001834)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019434286.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;