Transcript | Ll_transcript_14278 |
---|---|
CDS coordinates | 3-413 (+) |
Peptide sequence | EMCSLKDLNLNYCSKLRRLPDFDDTMECFSELYLEYCTNLLSLPNTISNLKSLKILDICGCSKVDRLPNNINENKALEDLDISYTSIREMDSSLFHLENLKRLIFDGCSGPTFKSQGKLLTSLWKGWRKRYQIINTE |
ORF Type | internal |
Blastp | Disease resistance protein TAO1 from Arabidopsis with 36.11% of identity |
---|---|
Blastx | Disease resistance protein TAO1 from Arabidopsis with 36.11% of identity |
Eggnog | leucine Rich Repeat(COG4886) |
Kegg | Link to kegg annotations (AT5G44510) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019441909.1) |
Pfam | Leucine Rich Repeat (PF00560.32) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer