Protein coding transcript 262069

• Transcript: Ll_transcript_14278
• CDS coordinates: 3-413 (+)
• Peptide sequence: EMCSLKDLNLNYCSKLRRLPDFDDTMECFSELYLEYCTNLLSLPNTISNLKSLKILDICGCSKVDRLPNNINENKALEDLDISYTSIREMDSSLFHLENLKRLIFDGCSGPTFKSQGKLLTSLWKGWRKRYQIINTE
• ORF Type: internal

Annotations of Ll_transcript_14278

• Blastp: Disease resistance protein TAO1 from Arabidopsis with 36.11% of identity
• Blastx: Disease resistance protein TAO1 from Arabidopsis with 36.11% of identity
• Eggnog: leucine Rich Repeat(COG4886)
• Kegg: Link to kegg annotations (AT5G44510)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019441909.1)
• Pfam: Leucine Rich Repeat (PF00560.32)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;