Protein coding transcript 262070

• Transcript: Ll_transcript_14281
• CDS coordinates: 127-1467 (+)
• Peptide sequence: MIFYRCISLETLPSKMEMCSLKYLDLDNCSKLRRLPDFDGKTECVSEMYLRNCTNLLSLPNTISNLKSLKIINIFGCSKVDRLPKNINENKALEELDMSYTSIREMDSSLFHLENLERLIFHGCSGPTFKSQGKPLTSLWKCWRKRYQIINTESLMLPRFISNLSSLTILDLRFCNLKSLPEDIGHLPSLEILDLRGNVGLSLHLASIANLSKLRILLFDGNMYGSRTLLPTHVRIYPQDLSADLSVVNGPKLWNSFKSCCNEEEHIEDCSPFLLFLTSSMSINKNYPSYYIDGPVLSRHDNSSAYIETDCGMGIWFGLVLFIVLEPEVSLSMPLMTNYIYIKWTFDSLDEDGGTFCYITSTTANSNHYVMTIIMNDDVAYVQRHQSGYHHKNESKHFINFWETVENSQLKIEVALKGRKIRKCWLQQLGKEDFRFESLTIPSTNL*
• ORF Type: complete

Annotations of Ll_transcript_14281

• Blastp: Disease resistance protein TAO1 from Arabidopsis with 36.18% of identity
• Blastx: TMV resistance protein N from Nicotiana with 32.75% of identity
• Eggnog: leucine Rich Repeat(COG4886)
• Kegg: Link to kegg annotations (AT5G44510)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019441909.1)
• Pfam: Leucine rich repeat (PF13855.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;