Protein coding transcript 262073

• Transcript: Ll_transcript_14287
• CDS coordinates: 127-1152 (+)
• Peptide sequence: MIFYRCISLETLPSKMEMCSLKYLDLDNCSKLRRLPDFDGKTECVSEMYLRNCTNLLSIPNTISNLKTLKILNISGCSKVDRLPNNINENKDLEDLDMSYTSIREVDSCLFQLENLKRLLFGGCCGPIFKSQGKLLTPLWKCWRKRYEIINTESLILPCFISNLSSLTMLELSYCNLKSLPEDIGHLPSLEILDLFGNVDLTLYLDSIANLPKLRLLLFDGNMYGSRTLLPTHVRIYPQDASVDASVVNGPKLWKLFRSYCNEDENFEDCSPFILQATASTTEYVNYPTYHIVGPVLSRHDSSLYIETDCGMRTWIGVVLFIVLEPEVSLSMPLMTNSIYIT
• ORF Type: 3prime_partial

Annotations of Ll_transcript_14287

• Blastp: TMV resistance protein N from Nicotiana with 31.51% of identity
• Blastx: TMV resistance protein N from Nicotiana with 32.28% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019441909.1)
• Pfam: Leucine rich repeats (6 copies) (PF13306.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;