Protein coding transcript 262088

• Transcript: Ll_transcript_16197
• CDS coordinates: 1-534 (+)
• Peptide sequence: DLTCSNVFEDISNLLSKSAFPVNSPLSSMHVLALDGLIAVIQGIAERIGDGSLSSEIFSVNLEEYTPFWLEKCENFSDPNNWVPFVCRRKCFKKRLMIGADHFNRDIKKGLEFLQGTHLLPDKLDPQSVAWFFRYTAGLDKNLIGDYLGNHDEFCVQVLDEFARTFDFKDMTLDNALR
• ORF Type: internal

Annotations of Ll_transcript_16197

• Blastp: ARF guanine-nucleotide exchange factor GNOM from Arabidopsis with 77.53% of identity
• Blastx: ARF guanine-nucleotide exchange factor GNOM from Arabidopsis with 77.53% of identity
• Eggnog: and Sec7 domain(COG5307)
• Kegg: Link to kegg annotations (AT1G13980)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019433110.1)
• Pfam: Sec7 domain (PF01369.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;