Transcript | Ll_transcript_524606 |
---|---|
CDS coordinates | 1-411 (+) |
Peptide sequence | ESMKDIIREEQIGFISIEELGNAMRSVDENPTIEELQIMMKEGDMDGKGTMEFGEFLNLMAIKMKETEAEEEFKEAFRVFDKDQDGYISPIELMFVMRSIGVKVTEEELGLMMNEADLDGDGLIDYQEFVRMMLSV* |
ORF Type | 5prime_partial |
Blastp | Calmodulin from Triticum with 60.16% of identity |
---|---|
Blastx | Calmodulin from Triticum with 60.16% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019418735.1) |
Pfam | EF-hand domain pair (PF13833.5) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer