Protein coding transcript 262104

• Transcript: Ll_transcript_13504
• CDS coordinates: 268-573 (+)
• Peptide sequence: MGMTKLKFKPAYNPYTEPSMEIFSYHEGFKKWVEVGNSGMFRPEMLQPMGLPEDVQVIAWGLSLERPTMILYGIDNIRDLFGHKVDLGLMKKNPICRLGIE*
• ORF Type: complete

Annotations of Ll_transcript_13504

• Blastp: Phenylalanine--tRNA ligase alpha subunit, cytoplasmic from Arabidopsis with 88% of identity
• Blastx: Phenylalanine--tRNA ligase alpha subunit, cytoplasmic from Arabidopsis with 79.58% of identity
• Eggnog: phenylalanyL-tRNA synthetase, alpha subunit(COG0016)
• Kegg: Link to kegg annotations (AT4G39280)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019413281.1)
• Pfam: tRNA synthetases class II core domain (F) (PF01409.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;