Protein coding transcript 262131

• Transcript: Ll_transcript_15743
• CDS coordinates: 629-925 (+)
• Peptide sequence: MADAHDVEGDGASLPFSERFLLTAKPLAKHVPMLLHDKERNSQVFYGNDSFYVLFRLHQTLYERIRSAKINSSSAERKWRASNDTSSTDQYDRFMNALY
• ORF Type: 3prime_partial

Annotations of Ll_transcript_15743

• Blastp: Paired amphipathic helix protein Sin3-like 3 from Arabidopsis with 66.67% of identity
• Blastx: Paired amphipathic helix protein Sin3-like 3 from Arabidopsis with 56.44% of identity
• Eggnog: Paired AMPhipathic helix protein(COG5602)
• Kegg: Link to kegg annotations (AT1G24190)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019423160.1)
• Pfam: C-terminal domain of Sin3a protein (PF16879.4)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;