Transcript | Ll_transcript_15750 |
---|---|
CDS coordinates | 1-564 (+) |
Peptide sequence | LLPKNYPIPLASQKTELGAEVLNDHWVSVTSGSEDYSFKHMRKNQYEESLFICEDDRFELDMLLESVNVTTKRVEELLEKINRNVIKGGSHIRIEEHLTALNLRCIERLYGDHGLDVMDVLRKNASLALPVILMRLKQKQDEWARCHSDFNIVWAEIYAKNYHKSLDHRSFYFKQQDTKSLSTKGSR* |
ORF Type | 5prime_partial |
Blastp | Paired amphipathic helix protein Sin3-like 3 from Arabidopsis with 83.78% of identity |
---|---|
Blastx | Paired amphipathic helix protein Sin3-like 3 from Arabidopsis with 83.78% of identity |
Eggnog | Paired AMPhipathic helix protein(COG5602) |
Kegg | Link to kegg annotations (AT1G24190) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019445514.1) |
Pfam | Sin3 family co-repressor (PF08295.11) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer