Protein coding transcript 262139

• Transcript: Ll_transcript_15737
• CDS coordinates: 1-714 (+)
• Peptide sequence: LLPKNYPIPLASQKTELGAEVLNDHWVSVTSGSEDYSFKHMRKNQYEESLFRCEDDRFELDMLLESVNVTTKRVEELLDKINRNILQGDSAIRIEEHLTALNLRCIERLYGDHGLDVMDVLRKNAPLALPVILTRLKQKQDEWARCRADFNKVWADIYAKNYHKSLDHRSFYFKQQDTKSLSTKALLAEIKEISEKKHKEDDVLLAIAAGNRRPILPNLEFEYPDPGIHEDLYQLIKY
• ORF Type: internal

Annotations of Ll_transcript_15737

• Blastp: Paired amphipathic helix protein Sin3-like 4 from Arabidopsis with 81.86% of identity
• Blastx: Paired amphipathic helix protein Sin3-like 4 from Arabidopsis with 81.86% of identity
• Eggnog: Paired AMPhipathic helix protein(COG5602)
• Kegg: Link to kegg annotations (AT1G70060)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019423158.1)
• Pfam: Sin3 family co-repressor (PF08295.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;