Protein coding transcript 262153

• Transcript: Ll_transcript_16112
• CDS coordinates: 2-349 (+)
• Peptide sequence: LKGLSMEDSWLLFENFAFKEREEKRFPDLIKVGREIVSKCRGVPLAIRLMGNMLFSNYEIHEWEFMRDVEFRDVAEHNSILPALPLSYLHIPPHLKQCFDCSPFIQIFLYFTVPK*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_16112

• Blastp: Putative disease resistance protein RGA3 from Solanum with 48.11% of identity
• Blastx: Putative disease resistance protein RGA3 from Solanum with 48.11% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019426157.1)
• Pfam: NB-ARC domain (PF00931.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;