| Transcript | Ll_transcript_16099 |
|---|---|
| CDS coordinates | 2-298 (+) |
| Peptide sequence | LLPSPNKDETLIDVANQCLHELMSRSFLEEFVNFGTSYYFQVHDLKNDLARSIAKDECHMVNSNIQNVPENVQHLSFAEDDLLGNSFTSKSIVVRTILF |
| ORF Type | internal |
| Blastp | Putative disease resistance protein At3g14460 from Arabidopsis with 35.44% of identity |
|---|---|
| Blastx | Putative disease resistance protein At3g14460 from Arabidopsis with 35.44% of identity |
| Eggnog | leucine Rich Repeat(COG4886) |
| Kegg | Link to kegg annotations (AT3G14460) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019425580.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer