Transcript | Ll_transcript_16100 |
---|---|
CDS coordinates | 3-977 (+) |
Peptide sequence | TLVEAEEQQINQLRNILQNEKFLLVLDDIWNDDPLKWSELRNLISSGMEGSKILLTTRSHSTAFMMGTIPSHTLKGLSMKDSLSLFQKFAFKEGQEKKFPDLIKVGREIVNKCGGVPFTITSMGSMLHSKYDIDEWKFMRDSEYWDLPRPNPILHALRLSYLHMPSHLKQCFELFSLYPDDFVFHSSEVASLWAALDLLPSPNKDETLIDVANRCLLELMSRSFFQNIFNFGTSYYFQIHDSTNGLARSIAKYECHIVSSNIQKVLENVQHLSFAKDDLLGNSFISKSIVVRTMLFPIEGVGASSATFLNMCVSRYTYFARIHW* |
ORF Type | 5prime_partial |
Blastp | Putative disease resistance protein RGA4 from Solanum with 43.15% of identity |
---|---|
Blastx | Putative disease resistance protein RGA4 from Solanum with 43.78% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019425580.1) |
Pfam | NB-ARC domain (PF00931.21) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer