Protein coding transcript 262178

• Transcript: Ll_transcript_15576
• CDS coordinates: 1-444 (+)
• Peptide sequence: LIAGLEYKPKSSYRLGSGDASREFWFETPPKVEPDVPYKFGIIGDLGQTFNSLSTLEHYLQSGAQTVLFVGDLSYADRYKYNDVGLRWDTWGRFAERSTAYQPWIWSVGHHEVDYMPYMGEDTPFKNFLNRYTTPYLASQSSSPLWYA
• ORF Type: internal

Annotations of Ll_transcript_15576

• Blastp: Bifunctional purple acid phosphatase 26 from Arabidopsis with 76.35% of identity
• Blastx: Bifunctional purple acid phosphatase 26 from Arabidopsis with 76.35% of identity
• Eggnog: Hydrolyzes cAMP to 5'-AMP. Plays an important regulatory role in modulating the intracellular concentration of cAMP, thereby influencing cAMP-dependent processes (By similarity)(COG1409)
• Kegg: Link to kegg annotations (AT5G34850)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019440736.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;