Protein coding transcript 262181

• Transcript: Ll_transcript_16294
• CDS coordinates: 624-1046 (+)
• Peptide sequence: MLPDDEDELLAGIMDDFDLSRLPNQLEDLDENDLFGSGGGLEMDFELQEGISVGISKISLSDGVPSNGFGHFAIPSGIGAVAGEHPYGEHPSRTLFVRNINSNVEDSELRSLFEQYGDIRTLYTACKHRGFVMISYYDIRA
• ORF Type: 3prime_partial

Annotations of Ll_transcript_16294

• Blastp: Protein MEI2-like 3 from Arabidopsis with 63.12% of identity
• Blastx: Protein MEI2-like 5 from Oryza sativa with 52.8% of identity
• Eggnog: Rna-binding protein(ENOG4111R9F)
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019456371.1)
• Pfam: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) (PF00076.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;