Protein coding transcript 262183

• Transcript: Ll_transcript_16303
• CDS coordinates: 295-975 (+)
• Peptide sequence: MDQHSGDSMPAHAAKGPLEILSLNVAKKVGSSAWGIPNGADAFHASSDASLFSSSLPILPHGKEKVHKEDEGQDPLEDITANAMGKMLPDDEDDLLAGIMDDFDLSRLPNQLEDLDENDLFGSGGGLEMDFEPQEGLSIGISKISLSDGAPSNGFGHFAIPNCIGAVAGEHPYGEHPSRTLFVRNINSNVEDSELRSLFEQYGDIRTLYTACKHRGFVMISYYDIRA
• ORF Type: 3prime_partial

Annotations of Ll_transcript_16303

• Blastp: Protein MEI2-like 5 from Arabidopsis with 53.6% of identity
• Blastx: Protein MEI2-like 3 from Arabidopsis with 61.18% of identity
• Eggnog: Rna-binding protein(ENOG4111R9F)
• Kegg: Link to kegg annotations (AT1G29400)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019461164.1)
• Pfam: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) (PF00076.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;