Protein coding transcript 262185

• Transcript: Ll_transcript_16310
• CDS coordinates: 295-930 (+)
• Peptide sequence: MDQHSGDSMPAHAAKGPLEILSLNVAKKVGSSAWGIPNGADAFHASSDASLFSSSLPILPHGKEKVHKEDEGQDPLEDITANAMGKMLPDDEDDLLAGIMDDFDLSRLPNQLEDLDENDLFGSGGGLEMDFEPQEGLSIGISKISLSDGAPSNGFGHFAIPNCIGAVAGEHPYGEHPSRTLFVRNINSNVEDSELRSLFEHGFLRVSKRKY*
• ORF Type: complete

Annotations of Ll_transcript_16310

• Blastp: Protein MEI2-like 5 from Arabidopsis with 47.96% of identity
• Blastx: Protein MEI2-like 3 from Arabidopsis with 54.55% of identity
• Eggnog: Rna-binding protein(ENOG4111R9F)
• Kegg: Link to kegg annotations (AT1G29400)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019461164.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;