Protein coding transcript 2622

• Transcript: Ll_transcript_524607
• CDS coordinates: 1-330 (+)
• Peptide sequence: ESMKDIIREEQIGFISIEELGNAMRSVDENPTIEELQIMMKEGDMDGKGTMEFGEFLNLMAIKMKLMFVMRSIGVKVTEEELGLMMNEADLDGDGLIDYQEFVRMMLSV*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_524607

• Blastp: Calmodulin-1 from Solanum with 44.72% of identity
• Blastx: Calmodulin-1 from Solanum with 44.72% of identity
• Eggnog: Calcium-binding protein(COG5126)
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019418735.1)
• Pfam: EF-hand domain pair (PF13833.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;