Protein coding transcript 262205

• Transcript: Ll_transcript_15527
• CDS coordinates: 2-385 (+)
• Peptide sequence: SHHENRSSLINMEEWPEWILEVLISNYEKGPSKLSDSTSVGDIEDLIHNFIIIMLEHSMRQKDGWKDIEATIHCAEWLSIVGGSSTGEQRIRREEALPIFKRRLLGDLLDFAARELQVQTQIIAAAAA
• ORF Type: internal

Annotations of Ll_transcript_15527

• Blastp: BEACH domain-containing protein C2 from Arabidopsis with 82.11% of identity
• Blastx: BEACH domain-containing protein C2 from Arabidopsis with 82.64% of identity
• Eggnog: beige BEACH domain containing protein(ENOG410XNQC)
• Kegg: Link to kegg annotations (AT2G45540)
• CantataDB: Link to cantataDB annotations (CNT0001256)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019412873.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;