Protein coding transcript 262212

• Transcript: Ll_transcript_15543
• CDS coordinates: 77-493 (+)
• Peptide sequence: MVQEPKENTLFLQRPEQLLKRIQLMERWARWEISNFEYLMQLNTLAGRSYNDITQYPVFPWILSDYSSKSLDISNPSSFRDLSKPVGALNPDRLKKFQERYSSFDDPVIPKFHYGSHYSSAGTVLYYLVRVEPFTTLAI
• ORF Type: 3prime_partial

Annotations of Ll_transcript_15543

• Blastp: BEACH domain-containing protein C2 from Arabidopsis with 85.4% of identity
• Blastx: BEACH domain-containing protein C2 from Arabidopsis with 83.1% of identity
• Eggnog: beige BEACH domain containing protein(ENOG410XNQC)
• Kegg: Link to kegg annotations (AT2G45540)
• CantataDB: Link to cantataDB annotations (CNT0001256)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019412874.1)
• Pfam: Beige/BEACH domain (PF02138.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;