Protein coding transcript 262215

• Transcript: Ll_transcript_15550
• CDS coordinates: 181-1230 (+)
• Peptide sequence: MEKAVSEKESRGPACTFEFDGESSGLLGPGESRWPFINGYAFATWIYIESFADALNTATVAAAIAAAAAAKSGKSSAMSAAAAASALAGEGTAHMPRLFSFLSADNQGIEAYFHAQFLVVEIGTGKGKRSALHFTYAFKPQCWYFIGVEHIGKHGVMGNVESEVRLYVDGSLYESRPFEFPRISKPLAFCCIGTNPPATMAGLQRRRRQCPLFAEMGPVYIFKEPIGLEKMARLASRGGDIVPSFGNAAGIPWLATNAHVQSKAEESVLLDAEIGGFIHLLYHPSLLSGRFCPDASPSGAAGTLRRPAEVLGQVHVATRMRPVDTLWALAYGGPLSLLPLAISSVHEETL
• ORF Type: 3prime_partial

Annotations of Ll_transcript_15550

• Blastp: BEACH domain-containing protein C2 from Arabidopsis with 84.29% of identity
• Blastx: BEACH domain-containing protein C2 from Arabidopsis with 78.59% of identity
• Eggnog: beige BEACH domain containing protein(ENOG410XNQC)
• Kegg: Link to kegg annotations (AT2G45540)
• CantataDB: Link to cantataDB annotations (CNT0001256)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019431479.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;