Protein coding transcript 262240

• Transcript: Ll_transcript_16123
• CDS coordinates: 1-564 (+)
• Peptide sequence: YDDAAIDSLLDRDQVGNEEATLEDEDEDGFLKAFKVANFEYVDEAQAAAEMAAQKRAMETLNSSERTNYWEELLKDKYQEHRVEEFNSLGKGKRNRKTMVSVEEDDLAGLEDVSSDGEDDNYEADLTDGDSNSTGATSARRPYKKKARAESTEPLPLMEGVGKSFRVLGFNQNQRATFVQILMRFGVG
• ORF Type: internal

Annotations of Ll_transcript_16123

• Blastp: CHD3-type chromatin-remodeling factor PICKLE from Arabidopsis with 63.87% of identity
• Blastx: CHD3-type chromatin-remodeling factor PICKLE from Arabidopsis with 61.05% of identity
• Eggnog: helicase activity(ENOG410XNUT)
• Kegg: Link to kegg annotations (AT2G25170)
• CantataDB: Link to cantataDB annotations (CNT0001593)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019437785.1)
• Pfam: Domain of Unknown Function (DUF1087) (PF06465.12)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;