| Transcript | Ll_transcript_16128 |
|---|---|
| CDS coordinates | 157-555 (+) |
| Peptide sequence | MIMLAFTISLADLSMQSDPNATVPNEEHKSEPMTTDLPSYTSGDPLTKMIDQLPQVEAIASQDFSLAAGDCGPNRLELVRNYNEMCKVVNGSTMDIAPIEVNVMKNLHQLETICEDVKRILTPTAENPGNGV* |
| ORF Type | complete |
| Blastp | CHD3-type chromatin-remodeling factor PICKLE from Arabidopsis with 26.32% of identity |
|---|---|
| Blastx | - |
| Eggnog | helicase activity(ENOG410XNUT) |
| Kegg | Link to kegg annotations (AT2G25170) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019447577.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer