Protein coding transcript 262252

• Transcript: Ll_transcript_16141
• CDS coordinates: 1331-1702 (+)
• Peptide sequence: MKELPPKKELILRVELSSKQKEYYKAILTRNYQILTRRGGAQISLINVVMELRKLCCHPYMLEGVEPDIGDANESFNQLLETSGKLQLLDKMMVKLKEQGHRVLIYSQFQHMLDLLEDYCSYK*
• ORF Type: complete

Annotations of Ll_transcript_16141

• Blastp: CHD3-type chromatin-remodeling factor PICKLE from Arabidopsis with 82.93% of identity
• Blastx: CHD3-type chromatin-remodeling factor PICKLE from Arabidopsis with 82.44% of identity
• Eggnog: helicase activity(ENOG410XNUT)
• Kegg: Link to kegg annotations (AT2G25170)
• CantataDB: -
• Mirbase: aly-MIR862 (MI0014628)
• Ncbi protein: Link to NCBI protein (XP_019437788.1)
• Pfam: SNF2 family N-terminal domain (PF00176.22)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;