Protein coding transcript 262255

• Transcript: Ll_transcript_16154
• CDS coordinates: 1-723 (+)
• Peptide sequence: TPLQNNLDELFMLMHFLDAGKFGSLEEFQEEFKDINQEEQVLRLHKMLAPHLLRRVKKDVMTELPPKKELILRVELSSKQKEYYKAILTRNYEILTRRGGAQISLINVVMELRKLCCHPYMFEGAQPHLDDTDEAFKQLLETSGKLQLLDKMMVKLKEQGHRVLVYTQFQHMLDLLEDYCSYKNWYYERIDGKVGGAERQIRIDRFNAKNSTRFCFLLSTRAGGIGINLATADTVIIYDR*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_16154

• Blastp: CHD3-type chromatin-remodeling factor PICKLE from Arabidopsis with 85.77% of identity
• Blastx: CHD3-type chromatin-remodeling factor PICKLE from Arabidopsis with 85.77% of identity
• Eggnog: helicase activity(ENOG410XNUT)
• Kegg: Link to kegg annotations (AT2G25170)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019447576.1)
• Pfam: SNF2 family N-terminal domain (PF00176.22)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;